(data stored in ACNUC9543 zone)

EMBL: CP000308.PE379

CP000308.PE379       Location/Qualifiers
FT   CDS             444649..445581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0380"
FT                   /product="bacterial peptide chain release factor 2 (bRF-2)"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12348"
FT                   /db_xref="GOA:A0A0E1P2F7"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1P2F7"
FT                   /protein_id="ABG12348.1"
FT                   /translation="MGKERSTLEEIVTTIDQLEQGLEDVSGLLELAVEADDEETFNETI
FT                   AELEVLDGKLGQLEFRRMFSGEYDRANCYLDLQAGSGGTEAQDWASMLLRMYLRWAESR
FT                   GFKTEIIEESDGDVAGLKSATVKIIGEYAFGWLRTETGVHRLVRKSPFDSGGRRHTSFS
FT                   SAFVYPEVDDDIDIEINPADLRIDVYRASGAGGQHVNKTESAVRITHIPTNIVTQCQND
FT                   RSQHKNKDQAMKQLKAKLYEFEMQKKNADKQVLEDNKSDIGWGSQIRSYVLDDSRIKDL
FT                   RTGVETRNTQAVLDGDLDKFIEASLKAGL"
     MGKERSTLEE IVTTIDQLEQ GLEDVSGLLE LAVEADDEET FNETIAELEV LDGKLGQLEF        60
     RRMFSGEYDR ANCYLDLQAG SGGTEAQDWA SMLLRMYLRW AESRGFKTEI IEESDGDVAG       120
     LKSATVKIIG EYAFGWLRTE TGVHRLVRKS PFDSGGRRHT SFSSAFVYPE VDDDIDIEIN       180
     PADLRIDVYR ASGAGGQHVN KTESAVRITH IPTNIVTQCQ NDRSQHKNKD QAMKQLKAKL       240
     YEFEMQKKNA DKQVLEDNKS DIGWGSQIRS YVLDDSRIKD LRTGVETRNT QAVLDGDLDK       300
     FIEASLKAGL                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page