(data stored in ACNUC9543 zone)

EMBL: CP000308.PE388

CP000308.PE388       Location/Qualifiers
FT   CDS             451904..452266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0389"
FT                   /product="putative DNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12357"
FT                   /db_xref="GOA:A0A0E1NVK2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NVK2"
FT                   /protein_id="ABG12357.1"
FT                   /translation="MAKLQYIHDEAGKPQFVVLPVAEYQQLISNAKYEDIPYVADNDDD
FT                   QTIPNEVVQIMVNDGVSLLAAWRIYRGFSQYEIAELLGTTQSAVSQWEAVDSRPQKKTR
FT                   EKLAAIYKCRAAQMIL"
     MAKLQYIHDE AGKPQFVVLP VAEYQQLISN AKYEDIPYVA DNDDDQTIPN EVVQIMVNDG        60
     VSLLAAWRIY RGFSQYEIAE LLGTTQSAVS QWEAVDSRPQ KKTREKLAAI YKCRAAQMIL       120
//

If you have problems or comments...

PBIL Back to PBIL home page