(data stored in ACNUC9543 zone)

EMBL: CP000308.PE389

CP000308.PE389       Location/Qualifiers
FT   CDS             452430..452726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12358"
FT                   /db_xref="GOA:A0A0E1NW62"
FT                   /db_xref="InterPro:IPR031451"
FT                   /db_xref="InterPro:IPR038493"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NW62"
FT                   /protein_id="ABG12358.1"
FT                   /translation="MEKRTPHTRLLKVKELVLKGNIKTTRTARDGAEELGLSFRDMCDA
FT                   VSELISADFYKSMTTHQDHTIWQDVYRPMLSCGRVYLKITVIDDVLNVSFKEI"
     MEKRTPHTRL LKVKELVLKG NIKTTRTARD GAEELGLSFR DMCDAVSELI SADFYKSMTT        60
     HQDHTIWQDV YRPMLSCGRV YLKITVIDDV LNVSFKEI                                98
//

If you have problems or comments...

PBIL Back to PBIL home page