(data stored in ACNUC9543 zone)

EMBL: CP000308.PE392

CP000308.PE392       Location/Qualifiers
FT   CDS             complement(455944..456603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0393"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12361"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4B4"
FT                   /protein_id="ABG12361.1"
FT                   /translation="MSALVHYSECIPFNVSSMMAKSWRSSRSYSALTAGFFSIRATTCS
FT                   WDRLGGWRLLSKSQLLHSFSGFAFLFPRHISRFLHHNMQNNNLPVYLCHKNDAVPAFRL
FT                   IKTQLKHIFVVMHRDSINHLNTVALHTFSQANKIGLQADGLGKKLGDDIIIVIFNGVVH
FT                   RLKNNRNVIFLRLRMYQKERPDITQYCRGVYPPRSKGGAVDTMSLRIFPLGATTGQ"
     MSALVHYSEC IPFNVSSMMA KSWRSSRSYS ALTAGFFSIR ATTCSWDRLG GWRLLSKSQL        60
     LHSFSGFAFL FPRHISRFLH HNMQNNNLPV YLCHKNDAVP AFRLIKTQLK HIFVVMHRDS       120
     INHLNTVALH TFSQANKIGL QADGLGKKLG DDIIIVIFNG VVHRLKNNRN VIFLRLRMYQ       180
     KERPDITQYC RGVYPPRSKG GAVDTMSLRI FPLGATTGQ                              219
//

If you have problems or comments...

PBIL Back to PBIL home page