(data stored in ACNUC9543 zone)

EMBL: CP000308.PE394

CP000308.PE394       Location/Qualifiers
FT   CDS             complement(456600..456800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0395"
FT                   /product="putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12363"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NN44"
FT                   /protein_id="ABG12363.1"
FT                   /translation="MTYSSLIRLPEVLKRTGFSRPWVYKLLKQKRFPPPIKIGGRAIAF
FT                   VESEVNDWIEQQIAHSRGNKQ"
     MTYSSLIRLP EVLKRTGFSR PWVYKLLKQK RFPPPIKIGG RAIAFVESEV NDWIEQQIAH        60
     SRGNKQ                                                                   66
//

If you have problems or comments...

PBIL Back to PBIL home page