(data stored in ACNUC9543 zone)

EMBL: CP000308.PE397

CP000308.PE397       Location/Qualifiers
FT   CDS             complement(457569..457934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12366"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NUF6"
FT                   /protein_id="ABG12366.1"
FT                   /translation="MINPAEKLKAKQQEFISIRELIQRISRLHPTMSQAQIANWLLIEL
FT                   TDARPVSPPLLIQDALGVTRSPGFDDPQFCYFDLLSAAMANPKMDGAPCDGWIPESYKP
FT                   DEFNHRPDEEDDHELPF"
     MINPAEKLKA KQQEFISIRE LIQRISRLHP TMSQAQIANW LLIELTDARP VSPPLLIQDA        60
     LGVTRSPGFD DPQFCYFDLL SAAMANPKMD GAPCDGWIPE SYKPDEFNHR PDEEDDHELP       120
     F                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page