(data stored in ACNUC9543 zone)

EMBL: CP000308.PE399

CP000308.PE399       Location/Qualifiers
FT   CDS             459852..461390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12368"
FT                   /db_xref="GOA:A0A0E1NTT3"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="InterPro:IPR016128"
FT                   /db_xref="InterPro:IPR036302"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NTT3"
FT                   /protein_id="ABG12368.1"
FT                   /translation="MAKGYYLVVGDETTCGGVITEGEPTHTIMGRAVAREQDRITCGKH
FT                   PGTYIIVGHIPGDTILGRKFAGSLHSTSNCPCKARFIPSMMNDAYELIGSPTSGQSSIA
FT                   PSFTETSESPPDVTPVFAKSCLREKGCTDAGTEGEPHRNFGKMGFYQTIPPSPTSPTDN
FT                   NEVDQRAQTARRKPVETEPDVKTPWYKRVLGRTSAAPAAVVVPVSTGAGLAALEQAGIQ
FT                   GMRFVGGNLMTAGRWMVGSSPVGAAIMGMMPGTLNEGETDLLDKLKLENIAKNGGSAPT
FT                   RVRFRWVDSGNGRLKAEGYHMSAEGGLDRVPVRKMTLNVFTGNYEFWEDGAAGPTILWT
FT                   PNDPGFKAPSNTGNNDGPIIRTTITVLPMPEADETGEHSTTLPMPEEKDFRDYILIHPL
FT                   LDLPPLYIYLSKNPDTPIWTKTKRLEPVSNAYEHWVKHGHEFSDQPFNNAKEYVESTHD
FT                   FVNNPPEGTLTKTRPNGDELFYHPQLNTFAVKTKDGVPKTMFKPSDKMGYWNKQ"
     MAKGYYLVVG DETTCGGVIT EGEPTHTIMG RAVAREQDRI TCGKHPGTYI IVGHIPGDTI        60
     LGRKFAGSLH STSNCPCKAR FIPSMMNDAY ELIGSPTSGQ SSIAPSFTET SESPPDVTPV       120
     FAKSCLREKG CTDAGTEGEP HRNFGKMGFY QTIPPSPTSP TDNNEVDQRA QTARRKPVET       180
     EPDVKTPWYK RVLGRTSAAP AAVVVPVSTG AGLAALEQAG IQGMRFVGGN LMTAGRWMVG       240
     SSPVGAAIMG MMPGTLNEGE TDLLDKLKLE NIAKNGGSAP TRVRFRWVDS GNGRLKAEGY       300
     HMSAEGGLDR VPVRKMTLNV FTGNYEFWED GAAGPTILWT PNDPGFKAPS NTGNNDGPII       360
     RTTITVLPMP EADETGEHST TLPMPEEKDF RDYILIHPLL DLPPLYIYLS KNPDTPIWTK       420
     TKRLEPVSNA YEHWVKHGHE FSDQPFNNAK EYVESTHDFV NNPPEGTLTK TRPNGDELFY       480
     HPQLNTFAVK TKDGVPKTMF KPSDKMGYWN KQ                                     512
//

If you have problems or comments...

PBIL Back to PBIL home page