(data stored in ACNUC9543 zone)

EMBL: CP000308.PE401

CP000308.PE401       Location/Qualifiers
FT   CDS             462862..465057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0402"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12370"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y337"
FT                   /protein_id="ABG12370.1"
FT                   /translation="MKINSKLWMGLLMGMLGMAVPPSQASSDNTGCVWGKYCPLSGVPF
FT                   LDVYNDTRVNMMLLVGEPKNFILPRLTMPADITRSRNYHFGEFYYDEMSFPKREKSLTD
FT                   ENNDSPSEETPFDKMAKTLGINSASFKGTNARYREARHISNNPASVEQFFTALLADSSL
FT                   TADDRHNLALWRSNIFHNVDAPVDGGITPPPFNIVPGSHVDAFSDYLHGANAFYRGDYP
FT                   EATALFSALQKSSQAWVAETATYMLFRVALNESSTNASDKYGMFETKNINQDAARQALD
FT                   YSRAYLVAYPQGIYAESIQGLERRIYWYLSDWQQLARLYEETLLAAPNAEALWDTVSEV
FT                   DAKFISKDAFGGEPFISDMQAPLLTFTQTLRWLRLGGRQSGSELEVTQEKLASYKPMFV
FT                   DADRLPLWQYLQTAWLYYHEQDYAGVVATVSAVDSLPATDIVTFSQQILYGDALVAQQQ
FT                   WSQAEAHWRKLLGLVQSPQQQQYLQLKLAAVLVNSDQIEAIFTADSPIKNLRYRSLILK
FT                   TKAQKALLQQQVISGANDEEKTIALHTLLLRDLMLGDYQGYEQDKQLSPHIQQSVDQKS
FT                   FADVDLAAFDWQGDNVEQGYACAALDGTVKALVKNKTDGHALNCLGEFFRVTDININTY
FT                   QEGEGNEVLNVAVHAHETVITQPNRFDYYQHVINDPKAEPEDKSYALYRAVMCYAPSGY
FT                   NQCGGEDVDIATRKRWFSSLKTQYKGSRWAERLNYYW"
     MKINSKLWMG LLMGMLGMAV PPSQASSDNT GCVWGKYCPL SGVPFLDVYN DTRVNMMLLV        60
     GEPKNFILPR LTMPADITRS RNYHFGEFYY DEMSFPKREK SLTDENNDSP SEETPFDKMA       120
     KTLGINSASF KGTNARYREA RHISNNPASV EQFFTALLAD SSLTADDRHN LALWRSNIFH       180
     NVDAPVDGGI TPPPFNIVPG SHVDAFSDYL HGANAFYRGD YPEATALFSA LQKSSQAWVA       240
     ETATYMLFRV ALNESSTNAS DKYGMFETKN INQDAARQAL DYSRAYLVAY PQGIYAESIQ       300
     GLERRIYWYL SDWQQLARLY EETLLAAPNA EALWDTVSEV DAKFISKDAF GGEPFISDMQ       360
     APLLTFTQTL RWLRLGGRQS GSELEVTQEK LASYKPMFVD ADRLPLWQYL QTAWLYYHEQ       420
     DYAGVVATVS AVDSLPATDI VTFSQQILYG DALVAQQQWS QAEAHWRKLL GLVQSPQQQQ       480
     YLQLKLAAVL VNSDQIEAIF TADSPIKNLR YRSLILKTKA QKALLQQQVI SGANDEEKTI       540
     ALHTLLLRDL MLGDYQGYEQ DKQLSPHIQQ SVDQKSFADV DLAAFDWQGD NVEQGYACAA       600
     LDGTVKALVK NKTDGHALNC LGEFFRVTDI NINTYQEGEG NEVLNVAVHA HETVITQPNR       660
     FDYYQHVIND PKAEPEDKSY ALYRAVMCYA PSGYNQCGGE DVDIATRKRW FSSLKTQYKG       720
     SRWAERLNYY W                                                            731
//

If you have problems or comments...

PBIL Back to PBIL home page