(data stored in ACNUC9543 zone)

EMBL: CP000308.PE404

CP000308.PE404       Location/Qualifiers
FT   CDS             467395..467700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12373"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y3Y9"
FT                   /protein_id="ABG12373.1"
FT                   /translation="MPISEINRKIEVYMKGVICIGDKTTHGGQVLSGSGKMKFAGIGVA
FT                   RLNDPVSCPQHGNTFIIEAHPSFKDNGIPVAFHGHRCGCGCTLISSQKGATVIAMR"
     MPISEINRKI EVYMKGVICI GDKTTHGGQV LSGSGKMKFA GIGVARLNDP VSCPQHGNTF        60
     IIEAHPSFKD NGIPVAFHGH RCGCGCTLIS SQKGATVIAM R                           101
//

If you have problems or comments...

PBIL Back to PBIL home page