(data stored in ACNUC9543 zone)

EMBL: CP000308.PE405

CP000308.PE405       Location/Qualifiers
FT   CDS             complement(467783..468103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0406"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12374"
FT                   /db_xref="InterPro:IPR024476"
FT                   /db_xref="InterPro:IPR038194"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NU02"
FT                   /protein_id="ABG12374.1"
FT                   /translation="MPGYRYRITIEPLTDRKGEAIDKAPVTFEAENHDEILSIIERLQA
FT                   REDLGFGQEKTAAFALGLKLFSETMMENRKHPLFEPLRGAFKDFMILLKKGSPRDRSDH
FT                   AE"
     MPGYRYRITI EPLTDRKGEA IDKAPVTFEA ENHDEILSII ERLQAREDLG FGQEKTAAFA        60
     LGLKLFSETM MENRKHPLFE PLRGAFKDFM ILLKKGSPRD RSDHAE                      106
//

If you have problems or comments...

PBIL Back to PBIL home page