(data stored in ACNUC9543 zone)

EMBL: CP000308.PE408

CP000308.PE408       Location/Qualifiers
FT   CDS             complement(470440..470958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0409"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12377"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQI5"
FT                   /protein_id="ABG12377.1"
FT                   /translation="MKNKIFTAIVLLFSFSLSIQAIANKKNDKKIIINNLTLSSTWVRT
FT                   AISESIDSPSNTINKDDIKRMAAGKHIYIMDNKITIEGVCTFKYVIKKSSPLNYWHSDK
FT                   TVNLYKEEFLKNGFKLSENLAFISAEDPSNDCDSPYSQIAITDNVIFTVYNGHIVFYTN
FT                   SNNVNELAL"
     MKNKIFTAIV LLFSFSLSIQ AIANKKNDKK IIINNLTLSS TWVRTAISES IDSPSNTINK        60
     DDIKRMAAGK HIYIMDNKIT IEGVCTFKYV IKKSSPLNYW HSDKTVNLYK EEFLKNGFKL       120
     SENLAFISAE DPSNDCDSPY SQIAITDNVI FTVYNGHIVF YTNSNNVNEL AL               172
//

If you have problems or comments...

PBIL Back to PBIL home page