(data stored in ACNUC9543 zone)

EMBL: CP000308.PE413

CP000308.PE413       Location/Qualifiers
FT   CDS             477769..479004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0414"
FT                   /product="putative sugar-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12382"
FT                   /db_xref="GOA:A0A0E1NXJ7"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NXJ7"
FT                   /protein_id="ABG12382.1"
FT                   /translation="MKINKITALVLTALAVTQFAGFAAHAATQQLTVWEDIKKSAGIKE
FT                   AIADFEKQHQVKVNVLEMPYAQQIEKLRLDGPAGIGPDVLVIPNDQLGGAVVQGLLTPL
FT                   SVDPTIVTTFTKPSIAAFTMDNALYGLPKAVETLVMIYNKDMLPTPLATLDEYAAFSKK
FT                   QRAENKYGLLAKFDQIYYSWGAIEPMGGYIFGKDANGSLKANDIGLNTPGAVEAVTYLK
FT                   TFYANGLFPIGTIGDNGLNAIDSLFTEKKAAAVINGPWAFQPYEAAGINFGVSPLPALP
FT                   NGKDMSSFLGVKGYVVSTWSKDKALAQQFIEFINQPQYVKTRYQVTKEIPALTAMIDDP
FT                   LIKNDEKASAVAIQASRASAMPGIPEMGEVWGPANSALELSVTGKQEPKVALDNAVKQI
FT                   NMQIEAMQASNQ"
     MKINKITALV LTALAVTQFA GFAAHAATQQ LTVWEDIKKS AGIKEAIADF EKQHQVKVNV        60
     LEMPYAQQIE KLRLDGPAGI GPDVLVIPND QLGGAVVQGL LTPLSVDPTI VTTFTKPSIA       120
     AFTMDNALYG LPKAVETLVM IYNKDMLPTP LATLDEYAAF SKKQRAENKY GLLAKFDQIY       180
     YSWGAIEPMG GYIFGKDANG SLKANDIGLN TPGAVEAVTY LKTFYANGLF PIGTIGDNGL       240
     NAIDSLFTEK KAAAVINGPW AFQPYEAAGI NFGVSPLPAL PNGKDMSSFL GVKGYVVSTW       300
     SKDKALAQQF IEFINQPQYV KTRYQVTKEI PALTAMIDDP LIKNDEKASA VAIQASRASA       360
     MPGIPEMGEV WGPANSALEL SVTGKQEPKV ALDNAVKQIN MQIEAMQASN Q                411
//

If you have problems or comments...

PBIL Back to PBIL home page