(data stored in ACNUC9543 zone)

EMBL: CP000308.PE415

CP000308.PE415       Location/Qualifiers
FT   CDS             480483..481334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0416"
FT                   /product="putative maltodextrin permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12384"
FT                   /db_xref="GOA:A0A0E1NSY3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NSY3"
FT                   /protein_id="ABG12384.1"
FT                   /translation="MAKSQSIKQEKWIRLSLSWLVIILVSVIIIYPLIWTVGASLNAGN
FT                   SLLSTSIIPENLSFQHYADLFNGEVNYMTWYWNSMKISFLTMVLTLISVSFTAYAFSRF
FT                   RFKGRQNGLMLFLLLQMIPQFSALIAIFVLSQLLGLINSHMALVLIYVAGMIPMNTYLM
FT                   KGYLDAIPKDLDESARMDGASNFRIFIEIIMPLSKPIVAVVALFSFTGPLGDFILSSTI
FT                   LRTPDKYTLPIGLYNLVAQKMGASYTTYAAGAVLIAVPVAILYLALQKYFVSGLTSGST
FT                   KG"
     MAKSQSIKQE KWIRLSLSWL VIILVSVIII YPLIWTVGAS LNAGNSLLST SIIPENLSFQ        60
     HYADLFNGEV NYMTWYWNSM KISFLTMVLT LISVSFTAYA FSRFRFKGRQ NGLMLFLLLQ       120
     MIPQFSALIA IFVLSQLLGL INSHMALVLI YVAGMIPMNT YLMKGYLDAI PKDLDESARM       180
     DGASNFRIFI EIIMPLSKPI VAVVALFSFT GPLGDFILSS TILRTPDKYT LPIGLYNLVA       240
     QKMGASYTTY AAGAVLIAVP VAILYLALQK YFVSGLTSGS TKG                         283
//

If you have problems or comments...

PBIL Back to PBIL home page