(data stored in ACNUC9543 zone)

EMBL: CP000308.PE42

CP000308.PE42        Location/Qualifiers
FT   CDS             complement(57627..58163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0042"
FT                   /product="insertion element IS1661 DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12011"
FT                   /db_xref="GOA:A0A0H2Y324"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y324"
FT                   /protein_id="ABG12011.1"
FT                   /translation="MIWRFGSMKHPFSTRLAAVQHYLSGKATLRETARQFSVGKSPLTR
FT                   WIRAFRRQGEAGLEHHLSRTYTPEFRLCVVRYMMANRCSAADASAHFNIPNETIIQNWM
FT                   KRYREGGKEALNPSKTGPTMPKDKYEHDSKPFSEMTHAELEKELEYLRAENAYLKKRKA
FT                   LREEKALREQQKKPE"
     MIWRFGSMKH PFSTRLAAVQ HYLSGKATLR ETARQFSVGK SPLTRWIRAF RRQGEAGLEH        60
     HLSRTYTPEF RLCVVRYMMA NRCSAADASA HFNIPNETII QNWMKRYREG GKEALNPSKT       120
     GPTMPKDKYE HDSKPFSEMT HAELEKELEY LRAENAYLKK RKALREEKAL REQQKKPE         178
//

If you have problems or comments...

PBIL Back to PBIL home page