(data stored in ACNUC9543 zone)

EMBL: CP000308.PE425

CP000308.PE425       Location/Qualifiers
FT   CDS             complement(494517..495371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0426"
FT                   /product="tagatose-bisphosphate aldolase catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12394"
FT                   /db_xref="GOA:A0A0E1NWJ7"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR011288"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NWJ7"
FT                   /protein_id="ABG12394.1"
FT                   /translation="MFLVSSREMLRQAQIGGYAIPAFNIHNLETIQAVVETAAEMASPV
FT                   ILAGTPSTFSYAGTEYLVQICQQAARHYRMPFALHLDHHESYDDITQKVAAGIKSIMID
FT                   GSHFNFEQNIALTRQVVEYCHRWDGTVEAELGRLGGQEDDLTVDEKDALYTDPGSAAHF
FT                   IQATGIDSLAIAIGTAHGMYKEAPSLDFDRLALIRRNTDIPLVLHGGSGIPDEDVRRCI
FT                   ELGISKVNVGTELKIAFSGALKAYFLENKGANDPRHYMVPAKAAMKKVIQDKINVCGSA
FT                   GKR"
     MFLVSSREML RQAQIGGYAI PAFNIHNLET IQAVVETAAE MASPVILAGT PSTFSYAGTE        60
     YLVQICQQAA RHYRMPFALH LDHHESYDDI TQKVAAGIKS IMIDGSHFNF EQNIALTRQV       120
     VEYCHRWDGT VEAELGRLGG QEDDLTVDEK DALYTDPGSA AHFIQATGID SLAIAIGTAH       180
     GMYKEAPSLD FDRLALIRRN TDIPLVLHGG SGIPDEDVRR CIELGISKVN VGTELKIAFS       240
     GALKAYFLEN KGANDPRHYM VPAKAAMKKV IQDKINVCGS AGKR                        284
//

If you have problems or comments...

PBIL Back to PBIL home page