(data stored in ACNUC9543 zone)

EMBL: CP000308.PE43

CP000308.PE43        Location/Qualifiers
FT   CDS             complement(58229..58498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0043"
FT                   /product="SSU ribosomal protein S15P"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12012"
FT                   /db_xref="GOA:Q1CC10"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CC10"
FT                   /protein_id="ABG12012.1"
FT                   /translation="MSLSVEAKAKIVADFGRGTNDTGSSEVQVALLTAQINHLQGHFSE
FT                   HKKDHHSRRGLLRMVSTRRKLLDYLKRQDVARYASLIERLGLRR"
     MSLSVEAKAK IVADFGRGTN DTGSSEVQVA LLTAQINHLQ GHFSEHKKDH HSRRGLLRMV        60
     STRRKLLDYL KRQDVARYAS LIERLGLRR                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page