(data stored in ACNUC9543 zone)

EMBL: CP000308.PE433

CP000308.PE433       Location/Qualifiers
FT   CDS             complement(503908..504798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0434"
FT                   /product="putative PTS permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12402"
FT                   /db_xref="GOA:A0A0E1NXF2"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NXF2"
FT                   /protein_id="ABG12402.1"
FT                   /translation="MASDITVDKDHTAKAKTDSLVDKIDSYQDLEVRKVVTRKDLWKCA
FT                   IRGLFMEGNFNFERMQAGGFAYSMIPALKKIHGNNRADLAKSLKNHLQFFNASPKLFTF
FT                   LLGTAVAMEENKEKPSMINVMKVAGMGPTGGIGDAIDHMTLMPLTLALGASIAIEGSIA
FT                   GPFVFFILYQTVHFLVYFGLMFMGYRAGTAAMVNMGDATEKLAKAANIMGIFVIGALCA
FT                   TFIRLQTTAAIDLGGKTVELQTALFDKIMPNLLPLALVFFMFKMVKGTGFWAKPPVLIF
FT                   STLAAGVVGHLLGIV"
     MASDITVDKD HTAKAKTDSL VDKIDSYQDL EVRKVVTRKD LWKCAIRGLF MEGNFNFERM        60
     QAGGFAYSMI PALKKIHGNN RADLAKSLKN HLQFFNASPK LFTFLLGTAV AMEENKEKPS       120
     MINVMKVAGM GPTGGIGDAI DHMTLMPLTL ALGASIAIEG SIAGPFVFFI LYQTVHFLVY       180
     FGLMFMGYRA GTAAMVNMGD ATEKLAKAAN IMGIFVIGAL CATFIRLQTT AAIDLGGKTV       240
     ELQTALFDKI MPNLLPLALV FFMFKMVKGT GFWAKPPVLI FSTLAAGVVG HLLGIV           296
//

If you have problems or comments...

PBIL Back to PBIL home page