(data stored in ACNUC9543 zone)

EMBL: CP000308.PE434

CP000308.PE434       Location/Qualifiers
FT   CDS             complement(504788..505576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0435"
FT                   /product="putative PTS permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12403"
FT                   /db_xref="GOA:A0A0E1NPS8"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NPS8"
FT                   /protein_id="ABG12403.1"
FT                   /translation="MLFEATLVGIWAFLCGIDKYDVALNIHRPLITGPVVGLIMGNMEV
FT                   GLIAGATLELAWLGLVPNAGAQPPDVTMGTIAAVAFAVMTGQSPEVAMGVGMPIAVLMQ
FT                   MIIIGFFAMTAFTMGRADKYAEQADTAGISRLLIGTLLTRSMLYFVIAFVTVYFGEHAA
FT                   TWIDENTPTALLEGLGIGAKMVPAIGFAMLLKIMWSKEVAGVFFIGFVMTTYLKLPIMA
FT                   IAILGAAVAVLYYFFSGNNNGSNNNGNNTNKQPEDFEDGI"
     MLFEATLVGI WAFLCGIDKY DVALNIHRPL ITGPVVGLIM GNMEVGLIAG ATLELAWLGL        60
     VPNAGAQPPD VTMGTIAAVA FAVMTGQSPE VAMGVGMPIA VLMQMIIIGF FAMTAFTMGR       120
     ADKYAEQADT AGISRLLIGT LLTRSMLYFV IAFVTVYFGE HAATWIDENT PTALLEGLGI       180
     GAKMVPAIGF AMLLKIMWSK EVAGVFFIGF VMTTYLKLPI MAIAILGAAV AVLYYFFSGN       240
     NNGSNNNGNN TNKQPEDFED GI                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page