(data stored in ACNUC9543 zone)

EMBL: CP000308.PE435

CP000308.PE435       Location/Qualifiers
FT   CDS             complement(505623..506120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0436"
FT                   /product="putative PTS transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12404"
FT                   /db_xref="GOA:A0A0E1NXD2"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR018455"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NXD2"
FT                   /protein_id="ABG12404.1"
FT                   /translation="MTRPNIVWTRIDERLLHGQIRITWGKHTEANLILVANDDAADGPN
FT                   SAFMQAGMKASAGGEYAVRFFSIQKTIDVIHKASPQQKVFILCNSPTDVARLVEGGVPI
FT                   TQCNVGNMHYHDGKRQIAKTVSVDEKDLDAFQRMAALGVACTVQNTPDQTPINVIELAA
FT                   RA"
     MTRPNIVWTR IDERLLHGQI RITWGKHTEA NLILVANDDA ADGPNSAFMQ AGMKASAGGE        60
     YAVRFFSIQK TIDVIHKASP QQKVFILCNS PTDVARLVEG GVPITQCNVG NMHYHDGKRQ       120
     IAKTVSVDEK DLDAFQRMAA LGVACTVQNT PDQTPINVIE LAARA                       165
//

If you have problems or comments...

PBIL Back to PBIL home page