(data stored in ACNUC9543 zone)

EMBL: CP000308.PE437

CP000308.PE437       Location/Qualifiers
FT   CDS             complement(507301..508599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0438"
FT                   /product="tagatose-bisphosphate aldolase noncatalytic
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12406"
FT                   /db_xref="GOA:A0A0E1NLF2"
FT                   /db_xref="InterPro:IPR012062"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NLF2"
FT                   /protein_id="ABG12406.1"
FT                   /translation="MHPLEKLVQRHKAGEQIGIYSVCSAHPLVIEAALEQALENDSELL
FT                   IEATSNQVDQFGGYTGMTPVDFRDYVFAKADALHFPLEKLILGGDHLGPNRWQHLPANE
FT                   AMAHADDLIAAYVAAGFKKIHLDCSMSCADDPVPLSDEIVAERAARLAAIAEATEYQHF
FT                   NTHTAVYVIGTEVPIPGGATEELDEIEVTSPEAARKTIECHQKAFEKSGVAECWPRVIG
FT                   LVVQPGVEFDHTGVIDFCPEKAHELSKVMDEYDYQVFEAHSTDYQTDDAYRALVKGHFA
FT                   ILKVGPALTFALREALFSLCHIEEELFPAEQCSRLRQVMEDVMLKSPEYWKRYYLGDTE
FT                   QVRLARVYSFSDRMRYYWPMEAVQAAQEKLFANLNSAPIPLPLLSQYMPRQFTAVREGT
FT                   LSFEATALVKQQIKNTLIGYVNACHLFNGNTSK"
     MHPLEKLVQR HKAGEQIGIY SVCSAHPLVI EAALEQALEN DSELLIEATS NQVDQFGGYT        60
     GMTPVDFRDY VFAKADALHF PLEKLILGGD HLGPNRWQHL PANEAMAHAD DLIAAYVAAG       120
     FKKIHLDCSM SCADDPVPLS DEIVAERAAR LAAIAEATEY QHFNTHTAVY VIGTEVPIPG       180
     GATEELDEIE VTSPEAARKT IECHQKAFEK SGVAECWPRV IGLVVQPGVE FDHTGVIDFC       240
     PEKAHELSKV MDEYDYQVFE AHSTDYQTDD AYRALVKGHF AILKVGPALT FALREALFSL       300
     CHIEEELFPA EQCSRLRQVM EDVMLKSPEY WKRYYLGDTE QVRLARVYSF SDRMRYYWPM       360
     EAVQAAQEKL FANLNSAPIP LPLLSQYMPR QFTAVREGTL SFEATALVKQ QIKNTLIGYV       420
     NACHLFNGNT SK                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page