(data stored in ACNUC9543 zone)

EMBL: CP000308.PE438

CP000308.PE438       Location/Qualifiers
FT   CDS             complement(508649..509425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0439"
FT                   /product="DeoR-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12407"
FT                   /db_xref="GOA:A0A0E1NNT4"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NNT4"
FT                   /protein_id="ABG12407.1"
FT                   /translation="MKAAIERRMEIFNIVTQQGKARVEDLAERFNVSSVTIRSDLSFLE
FT                   KNGYIVRSHGSAIPNTGVIAELTVHEKRRRNSGVKSLIGQAAAKLINSGDTVILDSGTT
FT                   TREIAANLRSVENVVVMTNGLDVAMELASAPGVEVLISGGVLRKSAMSFSGSQAEASLK
FT                   NFRFDKVFLGVDGFDLRVGITTYNEQEASLNRLMCDISEQIIAVADSTKFGKRSCHMIR
FT                   EFGDIDILVTDSDIPEEYVQRLRDMRIEVIIAEKEK"
     MKAAIERRME IFNIVTQQGK ARVEDLAERF NVSSVTIRSD LSFLEKNGYI VRSHGSAIPN        60
     TGVIAELTVH EKRRRNSGVK SLIGQAAAKL INSGDTVILD SGTTTREIAA NLRSVENVVV       120
     MTNGLDVAME LASAPGVEVL ISGGVLRKSA MSFSGSQAEA SLKNFRFDKV FLGVDGFDLR       180
     VGITTYNEQE ASLNRLMCDI SEQIIAVADS TKFGKRSCHM IREFGDIDIL VTDSDIPEEY       240
     VQRLRDMRIE VIIAEKEK                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page