(data stored in ACNUC9543 zone)

EMBL: CP000308.PE444

CP000308.PE444       Location/Qualifiers
FT   CDS             complement(514907..518020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12413"
FT                   /db_xref="GOA:A0A0E1NZQ2"
FT                   /db_xref="InterPro:IPR003159"
FT                   /db_xref="InterPro:IPR004103"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011071"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015176"
FT                   /db_xref="InterPro:IPR015177"
FT                   /db_xref="InterPro:IPR024200"
FT                   /db_xref="InterPro:IPR039174"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NZQ2"
FT                   /protein_id="ABG12413.1"
FT                   /translation="MYAPSRLKLIALTMTTLLGTAAYTPHLSANNTKSAKTEVSQKALM
FT                   QSSIIDFDGNQLPDFVTASSGSTLSLSSTRYIMGQQSLKWEWQAGSTMTIEHPITLVTD
FT                   KVASKTWGRKATQVLSFWIYNETPVDDYMIVDLGRGLGPSGAPDAGIKVKMNFSGWRTV
FT                   GVSLQNDLEGREIEGIGFDDNAEGESGGRSTIAGGAKSDMDSIRFRAPLKAPAGIFYID
FT                   RVMLSIDDARYQWSDDHVKTRYQIPEINFRLPAKLPAPTAGEIAAADDIRGALIRVFTE
FT                   GQGGENGLVVVDNREKLRAHFAALKIQRDADGQLSGRHIITDKQKVLYQPEFMDDIDQQ
FT                   RFSDYVLLGDYTTLMFNISRAYQRSTSEEVRQELADMYILMTQHLLDQGYMDGSGLVTT
FT                   HHWGYSSRWWYISAMLMANELDKHQLRQPVSDALLWYSREFKANFDMVPGPESSDLDYF
FT                   NTLSRQHLALLMLESDPAKRVALLKRFGEYINVALSQTPPGGYDGLRPDGTAWRHEGNY
FT                   PGYSFPAFKNAGQLVYMLHGTPFAVSDEGRAALKKAMLSAWVYSNPATSLGLAGRHPFN
FT                   SSSVTLFQDAFRWLALTGDPKTGDKVDKALAAAYLQITETPESESEAIFGVRIAPAELP
FT                   QGNWTFNGGAFGIHRFSDKMVTLKAYNSNVWSSEIYYRDNRYGRYQSHGAIQVLPYGNQ
FT                   KEIGFVQDGWDWNRNPGTTTIHLPLAELDSPNTHTLMLRGNHPFSGHSSLSGKYGMFAF
FT                   KFDAPSMPKFDSSFTARKSALETENRLVLLGSNISNNTEKYATETTLFQHGITDKASDL
FT                   WVNGERITALPYQRALEEGDWLIDGHGNGYLLTKGAKGEVRRQHQVSANDKSRDPTEGN
FT                   FSLAWLDHGAKPQNAQYEYLMVLEATPEGMQQLATDYRAGKKVYEVLRQDASAHIVRDN
FT                   VTQTTGYAAFSSVTPDEGVVKNIAQPAIVMTQMQSHGQLKISGVTPDLNMTRTTKATPL
FT                   AIAVTLNGQWQATENNPQVSVKLAGETTQLVFTSYFGMPQEVTLKPMN"
     MYAPSRLKLI ALTMTTLLGT AAYTPHLSAN NTKSAKTEVS QKALMQSSII DFDGNQLPDF        60
     VTASSGSTLS LSSTRYIMGQ QSLKWEWQAG STMTIEHPIT LVTDKVASKT WGRKATQVLS       120
     FWIYNETPVD DYMIVDLGRG LGPSGAPDAG IKVKMNFSGW RTVGVSLQND LEGREIEGIG       180
     FDDNAEGESG GRSTIAGGAK SDMDSIRFRA PLKAPAGIFY IDRVMLSIDD ARYQWSDDHV       240
     KTRYQIPEIN FRLPAKLPAP TAGEIAAADD IRGALIRVFT EGQGGENGLV VVDNREKLRA       300
     HFAALKIQRD ADGQLSGRHI ITDKQKVLYQ PEFMDDIDQQ RFSDYVLLGD YTTLMFNISR       360
     AYQRSTSEEV RQELADMYIL MTQHLLDQGY MDGSGLVTTH HWGYSSRWWY ISAMLMANEL       420
     DKHQLRQPVS DALLWYSREF KANFDMVPGP ESSDLDYFNT LSRQHLALLM LESDPAKRVA       480
     LLKRFGEYIN VALSQTPPGG YDGLRPDGTA WRHEGNYPGY SFPAFKNAGQ LVYMLHGTPF       540
     AVSDEGRAAL KKAMLSAWVY SNPATSLGLA GRHPFNSSSV TLFQDAFRWL ALTGDPKTGD       600
     KVDKALAAAY LQITETPESE SEAIFGVRIA PAELPQGNWT FNGGAFGIHR FSDKMVTLKA       660
     YNSNVWSSEI YYRDNRYGRY QSHGAIQVLP YGNQKEIGFV QDGWDWNRNP GTTTIHLPLA       720
     ELDSPNTHTL MLRGNHPFSG HSSLSGKYGM FAFKFDAPSM PKFDSSFTAR KSALETENRL       780
     VLLGSNISNN TEKYATETTL FQHGITDKAS DLWVNGERIT ALPYQRALEE GDWLIDGHGN       840
     GYLLTKGAKG EVRRQHQVSA NDKSRDPTEG NFSLAWLDHG AKPQNAQYEY LMVLEATPEG       900
     MQQLATDYRA GKKVYEVLRQ DASAHIVRDN VTQTTGYAAF SSVTPDEGVV KNIAQPAIVM       960
     TQMQSHGQLK ISGVTPDLNM TRTTKATPLA IAVTLNGQWQ ATENNPQVSV KLAGETTQLV      1020
     FTSYFGMPQE VTLKPMN                                                     1037
//

If you have problems or comments...

PBIL Back to PBIL home page