(data stored in ACNUC9543 zone)

EMBL: CP000308.PE451

CP000308.PE451       Location/Qualifiers
FT   CDS             524580..525113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0452"
FT                   /product="general secretion pathway protein C"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12420"
FT                   /db_xref="GOA:A0A0H2Y5E9"
FT                   /db_xref="InterPro:IPR024961"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y5E9"
FT                   /protein_id="ABG12420.1"
FT                   /translation="MLSLFIMRFFLLKIRLKNPFRTLNCNQFIFIELSIVFLVAFHTVM
FT                   VFWSIIYNDSNDMFILYDGQSYDSQNSTEKAKVIDSSNLSKMFDRKINKPDKKIEMNDV
FT                   LFYSPEYIGEIKLVGVIEHSAPSESIAILEVKGKQTTHLTRENINYEDIVIVKIFTDRV
FT                   IIKRNGKYYSLIIN"
     MLSLFIMRFF LLKIRLKNPF RTLNCNQFIF IELSIVFLVA FHTVMVFWSI IYNDSNDMFI        60
     LYDGQSYDSQ NSTEKAKVID SSNLSKMFDR KINKPDKKIE MNDVLFYSPE YIGEIKLVGV       120
     IEHSAPSESI AILEVKGKQT THLTRENINY EDIVIVKIFT DRVIIKRNGK YYSLIIN          177
//

If you have problems or comments...

PBIL Back to PBIL home page