(data stored in ACNUC9543 zone)

EMBL: CP000308.PE452

CP000308.PE452       Location/Qualifiers
FT   CDS             525194..527116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0453"
FT                   /product="general secretion pathway protein D"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12421"
FT                   /db_xref="GOA:A0A0E1NTF5"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR013356"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NTF5"
FT                   /protein_id="ABG12421.1"
FT                   /translation="MYISGKGIKSIHGMIFLFTLIMPLDIISANFSVSFKDVDIKEFIN
FT                   SVSKNINKTIIIDPTVQGLISIRSYENLDKDTYYQLFLNVLDVYGYAAIEMPHNVLKVI
FT                   SSKRAKGVVAPLPKEGVTFDGDELINRVIPLRYISAKKITPLLRQLNDNTESGSIINYD
FT                   PSNILLITGRAAVVNRLHSIVTDLDQAGDNEIELYKLNYAIAADVVKIVNEAINPINNL
FT                   KQEVSIVGKVIADERTNSILISGDTYIRKKSILMIKKLDKRQSSDGNTKVVYMKYAQAS
FT                   KLLDVLNGISEGFHNEKKTKQSNQWNQRPVAIKAYDQTNALVITADPDMMLALGEVIEK
FT                   LDIRRAQVLVEAIIVETQNGEGINLGVKWENKRSDDINFIKNSDGLLNNNGWGIATTIT
FT                   GLTAGFYKGNWDVLLSALSTNTNNNILATPSIVTLDNMEAEFNVGQEVPVLISTQTTTT
FT                   DKVYNSISRQSIGVMLKVKPQINKGDSVLLEIRQEVSSIADSSTVNTHNLGSVFNKRVV
FT                   NNAVLVKSGETVVVGGLLDKKSSTIVNKVPFLGDLPLIGWLFRQTKEKVEKSNLILFIK
FT                   PTILRESDDYSVVTSKEYNKYKKDNMNGYTLADDIVLSDKKYLSVIPSIRKDINNFYTL
FT                   LDSEL"
     MYISGKGIKS IHGMIFLFTL IMPLDIISAN FSVSFKDVDI KEFINSVSKN INKTIIIDPT        60
     VQGLISIRSY ENLDKDTYYQ LFLNVLDVYG YAAIEMPHNV LKVISSKRAK GVVAPLPKEG       120
     VTFDGDELIN RVIPLRYISA KKITPLLRQL NDNTESGSII NYDPSNILLI TGRAAVVNRL       180
     HSIVTDLDQA GDNEIELYKL NYAIAADVVK IVNEAINPIN NLKQEVSIVG KVIADERTNS       240
     ILISGDTYIR KKSILMIKKL DKRQSSDGNT KVVYMKYAQA SKLLDVLNGI SEGFHNEKKT       300
     KQSNQWNQRP VAIKAYDQTN ALVITADPDM MLALGEVIEK LDIRRAQVLV EAIIVETQNG       360
     EGINLGVKWE NKRSDDINFI KNSDGLLNNN GWGIATTITG LTAGFYKGNW DVLLSALSTN       420
     TNNNILATPS IVTLDNMEAE FNVGQEVPVL ISTQTTTTDK VYNSISRQSI GVMLKVKPQI       480
     NKGDSVLLEI RQEVSSIADS STVNTHNLGS VFNKRVVNNA VLVKSGETVV VGGLLDKKSS       540
     TIVNKVPFLG DLPLIGWLFR QTKEKVEKSN LILFIKPTIL RESDDYSVVT SKEYNKYKKD       600
     NMNGYTLADD IVLSDKKYLS VIPSIRKDIN NFYTLLDSEL                             640
//

If you have problems or comments...

PBIL Back to PBIL home page