(data stored in ACNUC9543 zone)

EMBL: CP000308.PE454

CP000308.PE454       Location/Qualifiers
FT   CDS             528766..529812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0455"
FT                   /product="putative general protein secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12423"
FT                   /db_xref="GOA:A0A0H2Y575"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y575"
FT                   /protein_id="ABG12423.1"
FT                   /translation="MVKKNSNKTDLVLITRQIATLVNASMPLDEVLDIVGKQNSKSKMI
FT                   EIIQRIRVNIQEGHSFADALSPFPAVFSPLYKTMVTAGEVSGHLGLVLVRLADHIEQTQ
FT                   KIQRKIIQALIYPCVLVLISLSVIIILLTAVVPNIVEQFSFSETALPLSTKVLMILSYS
FT                   IKENVIFIMAIGVSAVIFLNRLLKINKINVFFHRHYLSLPMLGNMFVRINTSRYLRTLT
FT                   TLHSNGVTIVQAMSISNAVLTNVYIKNKLNISVKLVSEGCSLSSSLVDSGVFPPIILHM
FT                   IISGERSGKLDHMLETVAGVQEEELMNQISIVMSLLEPTIIIVMAAFISFVILSILQPI
FT                   LEINSLVM"
     MVKKNSNKTD LVLITRQIAT LVNASMPLDE VLDIVGKQNS KSKMIEIIQR IRVNIQEGHS        60
     FADALSPFPA VFSPLYKTMV TAGEVSGHLG LVLVRLADHI EQTQKIQRKI IQALIYPCVL       120
     VLISLSVIII LLTAVVPNIV EQFSFSETAL PLSTKVLMIL SYSIKENVIF IMAIGVSAVI       180
     FLNRLLKINK INVFFHRHYL SLPMLGNMFV RINTSRYLRT LTTLHSNGVT IVQAMSISNA       240
     VLTNVYIKNK LNISVKLVSE GCSLSSSLVD SGVFPPIILH MIISGERSGK LDHMLETVAG       300
     VQEEELMNQI SIVMSLLEPT IIIVMAAFIS FVILSILQPI LEINSLVM                    348
//

If you have problems or comments...

PBIL Back to PBIL home page