(data stored in ACNUC9543 zone)

EMBL: CP000308.PE455

CP000308.PE455       Location/Qualifiers
FT   CDS             529832..530269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0456"
FT                   /product="general secretion pathway protein G"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12424"
FT                   /db_xref="GOA:A0A0H2Y435"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR010054"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013545"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y435"
FT                   /protein_id="ABG12424.1"
FT                   /translation="MANKKTKGFTLLEIMVVIVILGLLASLTIPSLMSNKNRADQQKAV
FT                   SDISALENALDMYRLDNGDYPTEQQGIAALVTKPNVPPLPQRYPSDGYIRRLPTDPWGN
FT                   SYQMNNPGKHGQIDIFSIGPDRLPETEDDIGNWITLSISET"
     MANKKTKGFT LLEIMVVIVI LGLLASLTIP SLMSNKNRAD QQKAVSDISA LENALDMYRL        60
     DNGDYPTEQQ GIAALVTKPN VPPLPQRYPS DGYIRRLPTD PWGNSYQMNN PGKHGQIDIF       120
     SIGPDRLPET EDDIGNWITL SISET                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page