(data stored in ACNUC9543 zone)

EMBL: CP000308.PE457

CP000308.PE457       Location/Qualifiers
FT   CDS             530854..531198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0458"
FT                   /product="general secretion pathway protein I"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12426"
FT                   /db_xref="GOA:A0A0H2Y388"
FT                   /db_xref="InterPro:IPR003413"
FT                   /db_xref="InterPro:IPR010052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y388"
FT                   /protein_id="ABG12426.1"
FT                   /translation="MLEVIIALTIFCIAGLSIMKIISERLRWINILEQRMISSWVAENV
FT                   LTEIKILKIEQTNEWLMGQESMAGQLWYWQSRSIKLQDDRMEIIAVEVRNNKESEHPDF
FT                   SLEGYKTTND"
     MLEVIIALTI FCIAGLSIMK IISERLRWIN ILEQRMISSW VAENVLTEIK ILKIEQTNEW        60
     LMGQESMAGQ LWYWQSRSIK LQDDRMEIIA VEVRNNKESE HPDFSLEGYK TTND             114
//

If you have problems or comments...

PBIL Back to PBIL home page