(data stored in ACNUC9543 zone)

EMBL: CP000308.PE458

CP000308.PE458       Location/Qualifiers
FT   CDS             531170..531787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0459"
FT                   /product="general secretion pathway protein J"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12427"
FT                   /db_xref="GOA:A0A0H2Y4H2"
FT                   /db_xref="InterPro:IPR010055"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4H2"
FT                   /protein_id="ABG12427.1"
FT                   /translation="MKAIKQPMIKRPDCGFTLLEMLLAVVIFSMISFIIYSSLRVTIKS
FT                   NNIMGNKVQELIRLHRVISLLERDISHSVMYIGSQNDYFSNEGRIIGIGVLDSDSFGIY
FT                   MLRNNKINTEIFIHYQHERLGYRLKKNCLERLSYLILKNTNKIETKFSCLIEGINDFRV
FT                   RIFHQGKWLNEWSRIDLSPQGIEIILDVKGVGVIRRFILLLH"
     MKAIKQPMIK RPDCGFTLLE MLLAVVIFSM ISFIIYSSLR VTIKSNNIMG NKVQELIRLH        60
     RVISLLERDI SHSVMYIGSQ NDYFSNEGRI IGIGVLDSDS FGIYMLRNNK INTEIFIHYQ       120
     HERLGYRLKK NCLERLSYLI LKNTNKIETK FSCLIEGIND FRVRIFHQGK WLNEWSRIDL       180
     SPQGIEIILD VKGVGVIRRF ILLLH                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page