(data stored in ACNUC9543 zone)

EMBL: CP000308.PE460

CP000308.PE460       Location/Qualifiers
FT   CDS             532736..533926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0461"
FT                   /product="general secretion pathway protein L"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12429"
FT                   /db_xref="GOA:A0A0E1NYM4"
FT                   /db_xref="InterPro:IPR007812"
FT                   /db_xref="InterPro:IPR024230"
FT                   /db_xref="InterPro:IPR025691"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NYM4"
FT                   /protein_id="ABG12429.1"
FT                   /translation="MSNIIDDVKLTFTLLIRLGETEFEPIYWYVESQGKKLVRHGKING
FT                   VAELKNITLYANNVVKILVPANKIIFRSLSIKKNEVMNNIKSIAFSIEQSISSDIDNFH
FT                   IVILDQDKDFCHVAAIEHELMNRWLFWLNINGISACCIMPDAFALPFFNSEWSVIKIES
FT                   NWLVRNNEMSGFLVNSSVLENILMLAEPTIKVNTFSPTDIKWGNWQSLDYSDPVLIMAK
FT                   TVSGNHVNLLSGKYKYAERIIVNNSVFLRVASWFFLLFLVMSLNGWYQGYKIVRDTGAL
FT                   SKVAQDFYADFLPPAYHGGDVNTSFNKYISDLDLKKNNVSFIKLLNAVSYYTADENVDV
FT                   RSFNFNYSDGEISFDIEGDDDLINEMLNDKTNLFNARVEVIRSGEDKYNIKLSSQP"
     MSNIIDDVKL TFTLLIRLGE TEFEPIYWYV ESQGKKLVRH GKINGVAELK NITLYANNVV        60
     KILVPANKII FRSLSIKKNE VMNNIKSIAF SIEQSISSDI DNFHIVILDQ DKDFCHVAAI       120
     EHELMNRWLF WLNINGISAC CIMPDAFALP FFNSEWSVIK IESNWLVRNN EMSGFLVNSS       180
     VLENILMLAE PTIKVNTFSP TDIKWGNWQS LDYSDPVLIM AKTVSGNHVN LLSGKYKYAE       240
     RIIVNNSVFL RVASWFFLLF LVMSLNGWYQ GYKIVRDTGA LSKVAQDFYA DFLPPAYHGG       300
     DVNTSFNKYI SDLDLKKNNV SFIKLLNAVS YYTADENVDV RSFNFNYSDG EISFDIEGDD       360
     DLINEMLNDK TNLFNARVEV IRSGEDKYNI KLSSQP                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page