(data stored in ACNUC9543 zone)

EMBL: CP000308.PE461

CP000308.PE461       Location/Qualifiers
FT   CDS             533923..534384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0462"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12430"
FT                   /db_xref="GOA:A0A0H2Y5G1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y5G1"
FT                   /protein_id="ABG12430.1"
FT                   /translation="MSYVMFLQHLFSAKRRVLLLYLLVISIPIVYYITSRVIEVRNNKL
FT                   LIKYSELSYHLQQHSIMAKKSNIKSHKKSDPIDIEINKSFKNKNIIFTVSLLDGGKCFV
FT                   EINSAKFSNLLDAIIDVSNKYDINVSSADIYLHQDDDDGYVAGKIIFFK"
     MSYVMFLQHL FSAKRRVLLL YLLVISIPIV YYITSRVIEV RNNKLLIKYS ELSYHLQQHS        60
     IMAKKSNIKS HKKSDPIDIE INKSFKNKNI IFTVSLLDGG KCFVEINSAK FSNLLDAIID       120
     VSNKYDINVS SADIYLHQDD DDGYVAGKII FFK                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page