(data stored in ACNUC9543 zone)

EMBL: CP000308.PE464

CP000308.PE464       Location/Qualifiers
FT   CDS             535893..536642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0465"
FT                   /product="putative regulatory membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12433"
FT                   /db_xref="GOA:A0A0H2Y585"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y585"
FT                   /protein_id="ABG12433.1"
FT                   /translation="MNTIVINDVFFTPQKRTIDRNGKVTKIRNKESELLSLLCEYYPEP
FT                   ISREDIEKRLWEGSYVTDNTLTQTISNLRHALDDKKHELVVTIPKKGYRIGIKPEIFIE
FT                   GEVQCQPYEKLGIIGSSVDKMAMSFLKGKMSFYRVCLFVLGVIFFFIFFNVALYRYQVK
FT                   LVDVNSLPILINLDKEQDKTFLSVYQQHPYVLLKKKKMAAMLFVNARETSWYAKKIIYS
FT                   ILFSILLGGGGGNYWYDLCLYTSDEKS"
     MNTIVINDVF FTPQKRTIDR NGKVTKIRNK ESELLSLLCE YYPEPISRED IEKRLWEGSY        60
     VTDNTLTQTI SNLRHALDDK KHELVVTIPK KGYRIGIKPE IFIEGEVQCQ PYEKLGIIGS       120
     SVDKMAMSFL KGKMSFYRVC LFVLGVIFFF IFFNVALYRY QVKLVDVNSL PILINLDKEQ       180
     DKTFLSVYQQ HPYVLLKKKK MAAMLFVNAR ETSWYAKKII YSILFSILLG GGGGNYWYDL       240
     CLYTSDEKS                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page