(data stored in ACNUC9543 zone)

EMBL: CP000308.PE465

CP000308.PE465       Location/Qualifiers
FT   CDS             536605..537006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0466"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12434"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NSW4"
FT                   /protein_id="ABG12434.1"
FT                   /translation="MIYAYIHPMKNLEGYWEGNYLLRTDSGNYHIFSRVNIINRSIQSS
FT                   MDVYDDRDQVKARCNTLFNIRSANNVFCVKMLSISFVDNEEKMLSDFLNTPYDVSYPIF
FT                   YRLDANTILIEQSQGHPVNSTRLLVRANI"
     MIYAYIHPMK NLEGYWEGNY LLRTDSGNYH IFSRVNIINR SIQSSMDVYD DRDQVKARCN        60
     TLFNIRSANN VFCVKMLSIS FVDNEEKMLS DFLNTPYDVS YPIFYRLDAN TILIEQSQGH       120
     PVNSTRLLVR ANI                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page