(data stored in ACNUC9543 zone)

EMBL: CP000308.PE467

CP000308.PE467       Location/Qualifiers
FT   CDS             complement(538838..539473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0468"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12436"
FT                   /db_xref="GOA:A0A0E1NYE8"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NYE8"
FT                   /protein_id="ABG12436.1"
FT                   /translation="MPGTTLHYIFDPLCGWCYGAAPLVQTAQNIPGLTLVLHGGGMMSG
FT                   ANRRQIDTQWRSYVMPHDKRIAELTGQTFGDNYFNQLLNDTSAIMDSTPPIAAILAAEA
FT                   LAGDGAKMLHRIQLAHYVEGRRIADTPVLTVLAADIGLNTEAFINAFNIAQKHAAQHIA
FT                   ESRTMLAKVQGHGFPTFILQDAAGKMTVVPAGDYFGNQPGWINRLTNA"
     MPGTTLHYIF DPLCGWCYGA APLVQTAQNI PGLTLVLHGG GMMSGANRRQ IDTQWRSYVM        60
     PHDKRIAELT GQTFGDNYFN QLLNDTSAIM DSTPPIAAIL AAEALAGDGA KMLHRIQLAH       120
     YVEGRRIADT PVLTVLAADI GLNTEAFINA FNIAQKHAAQ HIAESRTMLA KVQGHGFPTF       180
     ILQDAAGKMT VVPAGDYFGN QPGWINRLTN A                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page