(data stored in ACNUC9543 zone)

EMBL: CP000308.PE468

CP000308.PE468       Location/Qualifiers
FT   CDS             complement(539586..540473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12437"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQW0"
FT                   /protein_id="ABG12437.1"
FT                   /translation="MLNKMLLQITFASLVTASAIATAATTEPLKMEVYNPGEKSIFPVS
FT                   SEIISGKNEVVLIDAQFQRNDAEALVKKIQQSGKKLTTIYISQADPDFYFGLDVIAKAF
FT                   PQAKVIATPQTIEEIKATKDGKMAYWGPILKENAPTAVIIPQPLQGKSFTVDGQQIEVE
FT                   GLDGPSPEKTFVWIPSLKAVVGGVAVSGNIHLWVADTQTPESRENWLTTLEKIKALKPA
FT                   IVVPGHFLDNAPQTLESVTFTQNYLTTLNAEIPKAKDSAELIAVMKKHYPELKDESSLE
FT                   LSAKVLKNEMKWPQ"
     MLNKMLLQIT FASLVTASAI ATAATTEPLK MEVYNPGEKS IFPVSSEIIS GKNEVVLIDA        60
     QFQRNDAEAL VKKIQQSGKK LTTIYISQAD PDFYFGLDVI AKAFPQAKVI ATPQTIEEIK       120
     ATKDGKMAYW GPILKENAPT AVIIPQPLQG KSFTVDGQQI EVEGLDGPSP EKTFVWIPSL       180
     KAVVGGVAVS GNIHLWVADT QTPESRENWL TTLEKIKALK PAIVVPGHFL DNAPQTLESV       240
     TFTQNYLTTL NAEIPKAKDS AELIAVMKKH YPELKDESSL ELSAKVLKNE MKWPQ            295
//

If you have problems or comments...

PBIL Back to PBIL home page