(data stored in ACNUC9543 zone)

EMBL: CP000308.PE47

CP000308.PE47        Location/Qualifiers
FT   CDS             complement(62749..64236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0047"
FT                   /product="N utilization substance protein A"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12016"
FT                   /db_xref="GOA:A0A0E1NWM9"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NWM9"
FT                   /protein_id="ABG12016.1"
FT                   /translation="MNKEILAVVEAVSNEKSLPREKIFEALETALATATKKKYEQEIEV
FT                   RVSIDRKTGDFDTFRRWVAVDEVTMPTREITLDAAQFEDPSLQLGDYVEDQIESVTFDR
FT                   ITTQTAKQVIVQKVREAERAMVVEQFRQYLGQIVTGIVKKVSRDSIALDLGHNAEAVIG
FT                   REDMLPRENFRPGDRIRGVLYDVRPEARGAQLFVSRSRSEMLVELFRIEVPEIGEELIE
FT                   IKAAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSSELGGERIDIVLWDDNPA
FT                   QFVINAMAPADVASIVVDEDKHTMDVAVEASNLAQAIGRNGQNVRLAAQLSGWELNVMT
FT                   ADDLQAKHQAEAHAAIDTFTKYLDIDEDFATVLVEEGFSSLEELAYVPMKELLEIDGLD
FT                   EDTVEALRDRAKAALTTLALAQEESFGDQKPADDLLNLAGLERSMAFKLAARGVCTLED
FT                   LAEQGIDDLADIEGLSDEQAGELIMAARNICWFGDNA"
     MNKEILAVVE AVSNEKSLPR EKIFEALETA LATATKKKYE QEIEVRVSID RKTGDFDTFR        60
     RWVAVDEVTM PTREITLDAA QFEDPSLQLG DYVEDQIESV TFDRITTQTA KQVIVQKVRE       120
     AERAMVVEQF RQYLGQIVTG IVKKVSRDSI ALDLGHNAEA VIGREDMLPR ENFRPGDRIR       180
     GVLYDVRPEA RGAQLFVSRS RSEMLVELFR IEVPEIGEEL IEIKAAARDP GSRAKIAVKT       240
     NDKRIDPVGA CVGMRGARVQ AVSSELGGER IDIVLWDDNP AQFVINAMAP ADVASIVVDE       300
     DKHTMDVAVE ASNLAQAIGR NGQNVRLAAQ LSGWELNVMT ADDLQAKHQA EAHAAIDTFT       360
     KYLDIDEDFA TVLVEEGFSS LEELAYVPMK ELLEIDGLDE DTVEALRDRA KAALTTLALA       420
     QEESFGDQKP ADDLLNLAGL ERSMAFKLAA RGVCTLEDLA EQGIDDLADI EGLSDEQAGE       480
     LIMAARNICW FGDNA                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page