(data stored in ACNUC9543 zone)

EMBL: CP000308.PE477

CP000308.PE477       Location/Qualifiers
FT   CDS             complement(552873..553106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0478"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12446"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y450"
FT                   /protein_id="ABG12446.1"
FT                   /translation="MKCIKQTLGHYYIPVQKLIKGDGMPVFKFHKQTFLIFNQQKQAAL
FT                   SKEYKSQVKQLIEVNIIDISKGDICQQSEGSP"
     MKCIKQTLGH YYIPVQKLIK GDGMPVFKFH KQTFLIFNQQ KQAALSKEYK SQVKQLIEVN        60
     IIDISKGDIC QQSEGSP                                                       77
//

If you have problems or comments...

PBIL Back to PBIL home page