(data stored in ACNUC9543 zone)

EMBL: CP000308.PE478

CP000308.PE478       Location/Qualifiers
FT   CDS             complement(553813..554853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0479"
FT                   /product="putative aldo/keto reductase-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12447"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NY87"
FT                   /protein_id="ABG12447.1"
FT                   /translation="MQYHRIPHSSLEVSLLGLGTMTFGEQNSEADAHAQLDYAVAAGIN
FT                   LIDTAEMYPVPPRPETQGLTEQYIGRWIKARGCREKIILASKVSGPSRGDDQPIRPNMA
FT                   LDRKNIRIALEESLKRLNTDYLDIYQLHWPQRETNCFGKLNYRYSEQTAVVTLLETLEA
FT                   LNEQVRAGKIRYIGVSNETPWGVMRYLQLAEKHDLPRIVSIQNPYSLLNRSFEVGLAEI
FT                   SQHEGVELLAYSSLAFGTLSGKYLNGAKPAGARNTLFSRFTRYSGPQTQLAVAEYVSLA
FT                   KHHGLDPAQMALAFVRQQPFVASTLLGATSLEQLKSNIDSQNIVLSQEVLDALEAIHTR
FT                   YTFPAP"
     MQYHRIPHSS LEVSLLGLGT MTFGEQNSEA DAHAQLDYAV AAGINLIDTA EMYPVPPRPE        60
     TQGLTEQYIG RWIKARGCRE KIILASKVSG PSRGDDQPIR PNMALDRKNI RIALEESLKR       120
     LNTDYLDIYQ LHWPQRETNC FGKLNYRYSE QTAVVTLLET LEALNEQVRA GKIRYIGVSN       180
     ETPWGVMRYL QLAEKHDLPR IVSIQNPYSL LNRSFEVGLA EISQHEGVEL LAYSSLAFGT       240
     LSGKYLNGAK PAGARNTLFS RFTRYSGPQT QLAVAEYVSL AKHHGLDPAQ MALAFVRQQP       300
     FVASTLLGAT SLEQLKSNID SQNIVLSQEV LDALEAIHTR YTFPAP                      346
//

If you have problems or comments...

PBIL Back to PBIL home page