(data stored in ACNUC9543 zone)

EMBL: CP000308.PE480

CP000308.PE480       Location/Qualifiers
FT   CDS             complement(555242..555928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0481"
FT                   /product="DNA mismatch repair protein MutH"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12449"
FT                   /db_xref="GOA:Q1CAS3"
FT                   /db_xref="InterPro:IPR004230"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011337"
FT                   /db_xref="InterPro:IPR037057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAS3"
FT                   /protein_id="ABG12449.1"
FT                   /translation="MSVYSLPPAPPSDEHQLFQRAQALSGFTLGELATRAQWVIPADLK
FT                   RVKGWVGMLLEFYLGASAGSKPEQDFADIGIELKTIPISAQGKPLETTFVCVAPLTGNS
FT                   GVTWESSHVRHKLARVLWVPVEGERHIPLAERRVGAPLLWSPNVEEEELLRRDWEELMD
FT                   LIVLGKVESITARHGQVLQLRPKAANSRALTEAIGEFGQPIMTLPRGFYLKKTLTAPML
FT                   ARHFLL"
     MSVYSLPPAP PSDEHQLFQR AQALSGFTLG ELATRAQWVI PADLKRVKGW VGMLLEFYLG        60
     ASAGSKPEQD FADIGIELKT IPISAQGKPL ETTFVCVAPL TGNSGVTWES SHVRHKLARV       120
     LWVPVEGERH IPLAERRVGA PLLWSPNVEE EELLRRDWEE LMDLIVLGKV ESITARHGQV       180
     LQLRPKAANS RALTEAIGEF GQPIMTLPRG FYLKKTLTAP MLARHFLL                    228
//

If you have problems or comments...

PBIL Back to PBIL home page