(data stored in ACNUC9543 zone)

EMBL: CP000308.PE485

CP000308.PE485       Location/Qualifiers
FT   CDS             561572..562141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12454"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NM71"
FT                   /protein_id="ABG12454.1"
FT                   /translation="MKIYSIKTGKLLPKAPLLRKQKVFIKQRSLIKQRGISLIELLVVI
FT                   TLVSVMTLWGGQSWHHYRQRAKLADSARQLLAFLTHLQAEANRNNRTAILWAQPDGQGC
FT                   LGSGHKPTPPCTGLAGSLFIPPYRDIAITLPLQKEMGFYGVRNTAQAGNIILSSPAGRI
FT                   RLVISSRGRIRLCSEQQSMAGIHLCL"
     MKIYSIKTGK LLPKAPLLRK QKVFIKQRSL IKQRGISLIE LLVVITLVSV MTLWGGQSWH        60
     HYRQRAKLAD SARQLLAFLT HLQAEANRNN RTAILWAQPD GQGCLGSGHK PTPPCTGLAG       120
     SLFIPPYRDI AITLPLQKEM GFYGVRNTAQ AGNIILSSPA GRIRLVISSR GRIRLCSEQQ       180
     SMAGIHLCL                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page