(data stored in ACNUC9543 zone)

EMBL: CP000308.PE491

CP000308.PE491       Location/Qualifiers
FT   CDS             570078..573740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0492"
FT                   /product="DNA helicase/exodeoxyribonuclease V, beta
FT                   subunit"
FT                   /EC_number="3.1.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12460"
FT                   /db_xref="GOA:A0A0E1NV09"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR004586"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NV09"
FT                   /protein_id="ABG12460.1"
FT                   /translation="MTPTTPQRLEPLALPLYGERLIEASAGTGKTFTIGVLYLRLLLGL
FT                   GGDAAFRRPLMVEEILVVTFTEAATEELRGRIRDNIHGLRIACVRGVSDDPMYQALLAE
FT                   ITDWAVAAAQLLAAERQMDEAAIYTIHGFCQRMLANNAFESGILFEQTLVQDELPLWRQ
FT                   ACADFWRRHCYPLPLVIARAVSQEWSGPEALLSDLSAYLQGETPKFRQAPGDDETILSR
FT                   HQHVVTQIDALKAEWRLAAPELEALISRSGVDKRSYSSKHLPNWLEKVGLWAEQETEDY
FT                   QLPKELEKFRQSVLLEKTKKGAAPQHTLFSAIDSIFEQPLTLRDLILARAISEIRFSVQ
FT                   QEKRQRAELGFDDLLSKLDAALQQSGGELLAQSIRTRYPVAMIDEFQDTDPQQYRIFHT
FT                   VYGGQEACALLLIGDPKQAIYAFRGADIFTYIRARSEVSAHYTLETNWRSSFPMVQSVN
FT                   RLFSLVNTPFLFEQIPFINVAAAKKNHDLSFEIKGEKQPALHFWLQPGDGVGVSEYQQV
FT                   MARQCAAQIRDWLTAGQQGQAELLTTKGPKPVQASDITILVRSRAEAALIRDALSALAI
FT                   PSVYLSNRDSVFETTEAKDLLWLLQAVLAPEQERALRSAMATGILGLDARMLDALNHDE
FT                   RAWDALVDEFDHYRQHWQRRGVLPMLREMMARRHLAENLLATPGGERRLTDLLHLGELL
FT                   QEAASQLDSEHALIRWLAQQIAQPNPQSDSQQLRLESDRHLVRVVTIHKSKGLEYPLVW
FT                   LPFIGNFRQQQNVLYHDRHSFEALLDLNADEESQALAEEERLAEDLRLLYVALTRSVYH
FT                   CSVGIAPLIKGGRKKQGESDMHRSALGYLVQHGQPGDAHVLSEKLTELARSSNGDICVS
FT                   PVEPPDDKPWQPQPEALPELTARHFTRKMQDYWRVTSYSGLQQSGSTKKLYGSATGDVS
FT                   QALGAPLQVLLPRLDIDAVGEQAVVTEDDHLTPHTFPRGAAPGTFLHDLLEPLDFSQPI
FT                   ELAWLSERLQQQGFSEQWAPVLHQWLNDIVQTPLTDTGATLAGLSPERKQAELQFYLPI
FT                   DSLLRAEVLDRLIKQYDPLSRQCPVLDFQQVRGMLKGFIDLVFCWQGQYYLLDYKSNWL
FT                   GEDSRAYTVEAMTQAMAEHRYDLQYQLYTLALHRYLRHRLADYDYQRHFGGVIYLFLRG
FT                   VDQQHSGHGIFNCRPEQKLIEEMDRLFSGTIGSNATASDKSGSNVIHSGERASR"
     MTPTTPQRLE PLALPLYGER LIEASAGTGK TFTIGVLYLR LLLGLGGDAA FRRPLMVEEI        60
     LVVTFTEAAT EELRGRIRDN IHGLRIACVR GVSDDPMYQA LLAEITDWAV AAAQLLAAER       120
     QMDEAAIYTI HGFCQRMLAN NAFESGILFE QTLVQDELPL WRQACADFWR RHCYPLPLVI       180
     ARAVSQEWSG PEALLSDLSA YLQGETPKFR QAPGDDETIL SRHQHVVTQI DALKAEWRLA       240
     APELEALISR SGVDKRSYSS KHLPNWLEKV GLWAEQETED YQLPKELEKF RQSVLLEKTK       300
     KGAAPQHTLF SAIDSIFEQP LTLRDLILAR AISEIRFSVQ QEKRQRAELG FDDLLSKLDA       360
     ALQQSGGELL AQSIRTRYPV AMIDEFQDTD PQQYRIFHTV YGGQEACALL LIGDPKQAIY       420
     AFRGADIFTY IRARSEVSAH YTLETNWRSS FPMVQSVNRL FSLVNTPFLF EQIPFINVAA       480
     AKKNHDLSFE IKGEKQPALH FWLQPGDGVG VSEYQQVMAR QCAAQIRDWL TAGQQGQAEL       540
     LTTKGPKPVQ ASDITILVRS RAEAALIRDA LSALAIPSVY LSNRDSVFET TEAKDLLWLL       600
     QAVLAPEQER ALRSAMATGI LGLDARMLDA LNHDERAWDA LVDEFDHYRQ HWQRRGVLPM       660
     LREMMARRHL AENLLATPGG ERRLTDLLHL GELLQEAASQ LDSEHALIRW LAQQIAQPNP       720
     QSDSQQLRLE SDRHLVRVVT IHKSKGLEYP LVWLPFIGNF RQQQNVLYHD RHSFEALLDL       780
     NADEESQALA EEERLAEDLR LLYVALTRSV YHCSVGIAPL IKGGRKKQGE SDMHRSALGY       840
     LVQHGQPGDA HVLSEKLTEL ARSSNGDICV SPVEPPDDKP WQPQPEALPE LTARHFTRKM       900
     QDYWRVTSYS GLQQSGSTKK LYGSATGDVS QALGAPLQVL LPRLDIDAVG EQAVVTEDDH       960
     LTPHTFPRGA APGTFLHDLL EPLDFSQPIE LAWLSERLQQ QGFSEQWAPV LHQWLNDIVQ      1020
     TPLTDTGATL AGLSPERKQA ELQFYLPIDS LLRAEVLDRL IKQYDPLSRQ CPVLDFQQVR      1080
     GMLKGFIDLV FCWQGQYYLL DYKSNWLGED SRAYTVEAMT QAMAEHRYDL QYQLYTLALH      1140
     RYLRHRLADY DYQRHFGGVI YLFLRGVDQQ HSGHGIFNCR PEQKLIEEMD RLFSGTIGSN      1200
     ATASDKSGSN VIHSGERASR                                                  1220
//

If you have problems or comments...

PBIL Back to PBIL home page