(data stored in ACNUC9543 zone)

EMBL: CP000308.PE496

CP000308.PE496       Location/Qualifiers
FT   CDS             580698..581525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0497"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12465"
FT                   /db_xref="GOA:A0A0E1NMY7"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMY7"
FT                   /protein_id="ABG12465.1"
FT                   /translation="MSTAYSEAYQQRFGGIARLYGQQALALFSQAHVCVIGIGGVGSWA
FT                   AEALARTGIGAITLIDMDDVCVTNTNRQIHALRHNIGQAKTEVMAERILAINPECHVTC
FT                   IDDFITADNVAELLNKNFSYVIDAIDSVRPKAALLSYCRRYKIPVVTTGGAGGQIDPTR
FT                   IAVVDLAKTIQDPLAAKLRERLKSDFNVVKNSKGKLGIDCVFSSEPLVYPQADGSVCAS
FT                   RSTAEGPKKMDCTSGFGSATMVTATFGFVAVSHVLKKMMAKAARQHESAATAS"
     MSTAYSEAYQ QRFGGIARLY GQQALALFSQ AHVCVIGIGG VGSWAAEALA RTGIGAITLI        60
     DMDDVCVTNT NRQIHALRHN IGQAKTEVMA ERILAINPEC HVTCIDDFIT ADNVAELLNK       120
     NFSYVIDAID SVRPKAALLS YCRRYKIPVV TTGGAGGQID PTRIAVVDLA KTIQDPLAAK       180
     LRERLKSDFN VVKNSKGKLG IDCVFSSEPL VYPQADGSVC ASRSTAEGPK KMDCTSGFGS       240
     ATMVTATFGF VAVSHVLKKM MAKAARQHES AATAS                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page