(data stored in ACNUC9543 zone)

EMBL: CP000308.PE500

CP000308.PE500       Location/Qualifiers
FT   CDS             585087..585482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12469"
FT                   /db_xref="InterPro:IPR006696"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NLK3"
FT                   /protein_id="ABG12469.1"
FT                   /translation="MNSRLMLIFSALSGFFYVAFGAFGAHVLSTSLGLNEMAWIRTGLE
FT                   YQGFHTLVILILAVAMQRQVSLWFYWSGALLALGTLLFSGSLYCLALSHLRLWIYITPV
FT                   GGVCFLAGWILMLIGALRLRKRAERHE"
     MNSRLMLIFS ALSGFFYVAF GAFGAHVLST SLGLNEMAWI RTGLEYQGFH TLVILILAVA        60
     MQRQVSLWFY WSGALLALGT LLFSGSLYCL ALSHLRLWIY ITPVGGVCFL AGWILMLIGA       120
     LRLRKRAERH E                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page