(data stored in ACNUC9543 zone)

EMBL: CP000308.PE502

CP000308.PE502       Location/Qualifiers
FT   CDS             complement(586832..586987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0503"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12471"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y5B0"
FT                   /protein_id="ABG12471.1"
FT                   /translation="MWITIAPFVTPEKWRKKLQQHQQMAFTCKQIATLKTDLLLSGNLQ
FT                   QLRLKK"
     MWITIAPFVT PEKWRKKLQQ HQQMAFTCKQ IATLKTDLLL SGNLQQLRLK K                 51
//

If you have problems or comments...

PBIL Back to PBIL home page