(data stored in ACNUC9543 zone)

EMBL: CP000308.PE506

CP000308.PE506       Location/Qualifiers
FT   CDS             complement(589807..591171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12475"
FT                   /db_xref="InterPro:IPR021826"
FT                   /db_xref="InterPro:IPR027820"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="InterPro:IPR037153"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NVU3"
FT                   /protein_id="ABG12475.1"
FT                   /translation="MITHVSPLGSMDLLSQLEVDMLKRTASSDLYRLFRNCSLAVLNSG
FT                   SLTDNSKELLSRNETFDINVLRRERGVKLELVNPPEHAFVDGKIIRSLQANLFAVLRDI
FT                   LFVNGQIVSASNFQHLNMESSSHLTNLVFSILRNARALHIDEEPNMVVCWGGHSINETE
FT                   YLYARKVGSQLGLRELNICTGCGPGAMEAPMKGAAVGHAQQHYKKGRFIGMTEPSIIAA
FT                   EPPNPLVNELVIMPDIEKRLEAFVRIAHGIIIFPGGVGTAEELLYLLGILMNPENSEQV
FT                   LPLILTGPKESADYFKVVDEFIMNTLGDGARKYYQIIIDDPDEVARQMKKAMPLVKEYR
FT                   RNTGDAYSFNWSIRIEPDLQHPFEPNHENMANLDLSHNQPPEKLAAALRRAFSGIVAGN
FT                   VKEVGIQAIEAHGPFKLHGDPQLMKQMDRLLQDFIAQHRMKLPGSVYTPCYEICS"
     MITHVSPLGS MDLLSQLEVD MLKRTASSDL YRLFRNCSLA VLNSGSLTDN SKELLSRNET        60
     FDINVLRRER GVKLELVNPP EHAFVDGKII RSLQANLFAV LRDILFVNGQ IVSASNFQHL       120
     NMESSSHLTN LVFSILRNAR ALHIDEEPNM VVCWGGHSIN ETEYLYARKV GSQLGLRELN       180
     ICTGCGPGAM EAPMKGAAVG HAQQHYKKGR FIGMTEPSII AAEPPNPLVN ELVIMPDIEK       240
     RLEAFVRIAH GIIIFPGGVG TAEELLYLLG ILMNPENSEQ VLPLILTGPK ESADYFKVVD       300
     EFIMNTLGDG ARKYYQIIID DPDEVARQMK KAMPLVKEYR RNTGDAYSFN WSIRIEPDLQ       360
     HPFEPNHENM ANLDLSHNQP PEKLAAALRR AFSGIVAGNV KEVGIQAIEA HGPFKLHGDP       420
     QLMKQMDRLL QDFIAQHRMK LPGSVYTPCY EICS                                   454
//

If you have problems or comments...

PBIL Back to PBIL home page