(data stored in ACNUC9543 zone)

EMBL: CP000308.PE510

CP000308.PE510       Location/Qualifiers
FT   CDS             594254..594586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12479"
FT                   /db_xref="InterPro:IPR007384"
FT                   /db_xref="InterPro:IPR023376"
FT                   /db_xref="InterPro:IPR036814"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NTR7"
FT                   /protein_id="ABG12479.1"
FT                   /translation="MSTENKVRQSLQDIEFAMRETDLWQTVPPEAEAFESNEPFSIDTM
FT                   AAEQWLQWVFLPRMYALLELNGPFPTRFAITPYFEEALSGDGRPDYSALLAQLRCLDDL
FT                   LNKESE"
     MSTENKVRQS LQDIEFAMRE TDLWQTVPPE AEAFESNEPF SIDTMAAEQW LQWVFLPRMY        60
     ALLELNGPFP TRFAITPYFE EALSGDGRPD YSALLAQLRC LDDLLNKESE                  110
//

If you have problems or comments...

PBIL Back to PBIL home page