(data stored in ACNUC9543 zone)

EMBL: CP000308.PE515

CP000308.PE515       Location/Qualifiers
FT   CDS             complement(597438..600119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0516"
FT                   /product="(protein-PII) uridylyltransferase"
FT                   /EC_number="2.7.7.59"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12484"
FT                   /db_xref="GOA:Q1CAN8"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAN8"
FT                   /protein_id="ABG12484.1"
FT                   /translation="MSDNHTEHSLSLTLTPTISEQPALPSTYLDSDIHCPILKQRLDAF
FT                   QRWQAEAFNSGTSAEVLIAARSDYIDHLLQRLWTFYGFDKVPETALVAVGGYGRGELHP
FT                   LSDIDVLVLSKQRLNDEQAQRVGQLITLLWDLKLEVGHSVRTLEECLLEGLADLTIATN
FT                   MIESRLICGDVALFLQMQKHIFSDSFWPSPQFFHAKVVEQQERHKRYHGTSYNLEPDIK
FT                   SSPGGLRDIHTLLWVARRHFGATSLSEMVDFGFLTNAERNELNESQSFLWRIRFALHLV
FT                   LTRYDNRLLFDRQLSVAQLLRYEGEGNEPVEHMMKDFYRMTRRVSELNNMLLQLFDEAI
FT                   LALDANEKPRPLDEEFQLRGDLIDLRDENLFVRQPEAIMRMFYLMVRNQDIKGIYSTTV
FT                   RRLRHARRHLKAPLCHIPEARKLFMAILRHPGAVSRALLPMHRHSVLWAYMPQWGSIVG
FT                   QMQFDLFHAYTVDEHTIRVLLKIESFADEDTRPRHPLCVELYPRLPQPELLLLAALFHD
FT                   IAKGRGGDHSILGAHDAVEFAEQHGLNSRESQLVAWLVRCHLLMSVTAQRRDIQDPAVI
FT                   QQFSAEVQSETRLRYLVSLTVADICATNENLWNSWKQSLLRELYFATEKQLRRGMQNSP
FT                   DLRERVRHHRLQALALLRMDNIDEEALHRIWSRCRADYFLRHSPNQLAWHARHLLEHDS
FT                   TKPLVLVSRQATRGGTEIFIWSPDRPSLFAAVVGELDRRNLSVHDAQIFTNRDGMAMDT
FT                   FIVLEPDGSPLAQDRHPIISHALQQAINRSDYQHPPRVRRLSPKLRHFSVPTEANFLPT
FT                   HNERRTYLELIALDQPGLLARVGKIFADLGLSLHSARITTIGERVEDLFVLADKDRRAL
FT                   SLETRRELAQRLADTLNPNDKL"
     MSDNHTEHSL SLTLTPTISE QPALPSTYLD SDIHCPILKQ RLDAFQRWQA EAFNSGTSAE        60
     VLIAARSDYI DHLLQRLWTF YGFDKVPETA LVAVGGYGRG ELHPLSDIDV LVLSKQRLND       120
     EQAQRVGQLI TLLWDLKLEV GHSVRTLEEC LLEGLADLTI ATNMIESRLI CGDVALFLQM       180
     QKHIFSDSFW PSPQFFHAKV VEQQERHKRY HGTSYNLEPD IKSSPGGLRD IHTLLWVARR       240
     HFGATSLSEM VDFGFLTNAE RNELNESQSF LWRIRFALHL VLTRYDNRLL FDRQLSVAQL       300
     LRYEGEGNEP VEHMMKDFYR MTRRVSELNN MLLQLFDEAI LALDANEKPR PLDEEFQLRG       360
     DLIDLRDENL FVRQPEAIMR MFYLMVRNQD IKGIYSTTVR RLRHARRHLK APLCHIPEAR       420
     KLFMAILRHP GAVSRALLPM HRHSVLWAYM PQWGSIVGQM QFDLFHAYTV DEHTIRVLLK       480
     IESFADEDTR PRHPLCVELY PRLPQPELLL LAALFHDIAK GRGGDHSILG AHDAVEFAEQ       540
     HGLNSRESQL VAWLVRCHLL MSVTAQRRDI QDPAVIQQFS AEVQSETRLR YLVSLTVADI       600
     CATNENLWNS WKQSLLRELY FATEKQLRRG MQNSPDLRER VRHHRLQALA LLRMDNIDEE       660
     ALHRIWSRCR ADYFLRHSPN QLAWHARHLL EHDSTKPLVL VSRQATRGGT EIFIWSPDRP       720
     SLFAAVVGEL DRRNLSVHDA QIFTNRDGMA MDTFIVLEPD GSPLAQDRHP IISHALQQAI       780
     NRSDYQHPPR VRRLSPKLRH FSVPTEANFL PTHNERRTYL ELIALDQPGL LARVGKIFAD       840
     LGLSLHSARI TTIGERVEDL FVLADKDRRA LSLETRRELA QRLADTLNPN DKL              893
//

If you have problems or comments...

PBIL Back to PBIL home page