(data stored in ACNUC9543 zone)

EMBL: CP000308.PE517

CP000308.PE517       Location/Qualifiers
FT   CDS             601405..602130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0518"
FT                   /product="SSU ribosomal protein S2P"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12486"
FT                   /db_xref="GOA:Q1CAN6"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAN6"
FT                   /protein_id="ABG12486.1"
FT                   /translation="MATVSMRDMLQAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEK
FT                   TVPMFNEALAELTKISSRKGKILFVGTKRAASEAVKEAANNCDQFFVNHRWLGGMLTNW
FT                   KTVRQSIKRLKDLEIQSQDGTFDKLTKKEALMRTRELNKLENSLGGIKDMGGLPDALFV
FT                   VDADHEHIAIKEANNLGIPVFSIVDTNSDPDGVDFIIPGNDDAIRAVKLYLGAVATAVR
FT                   EGRSQDLAVQAEESFVEAE"
     MATVSMRDML QAGVHFGHQT RYWNPKMKPF IFGARNKVHI INLEKTVPMF NEALAELTKI        60
     SSRKGKILFV GTKRAASEAV KEAANNCDQF FVNHRWLGGM LTNWKTVRQS IKRLKDLEIQ       120
     SQDGTFDKLT KKEALMRTRE LNKLENSLGG IKDMGGLPDA LFVVDADHEH IAIKEANNLG       180
     IPVFSIVDTN SDPDGVDFII PGNDDAIRAV KLYLGAVATA VREGRSQDLA VQAEESFVEA       240
     E                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page