(data stored in ACNUC9543 zone)

EMBL: CP000308.PE531

CP000308.PE531       Location/Qualifiers
FT   CDS             614883..615671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0532"
FT                   /product="acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine
FT                   O-acyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12500"
FT                   /db_xref="GOA:Q1CAM2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAM2"
FT                   /protein_id="ABG12500.1"
FT                   /translation="MIDKTAFIHPSSIVEEGAIIGAGVYIGPFCIVGSQVEIGAGTELK
FT                   SHVVVNGITKIGCDNQIYQFASIGEANQDLKYAGEPTRVEVGDRNRIRESVTIHRGTTQ
FT                   GGGVTKVGCDNLLMVNTHVAHDCVIGNRCILANNAALGGHVEIDDYAIIGGMTAIHQFC
FT                   VIGAHVMVGGCSGITQDVPPFVIAQGNHATPFGINIEGLKRRGFDKESLHAIRSAYKLL
FT                   YRSGRTLDEVKPEIAELAEQYPVVKAFNDFFARSTRGIIR"
     MIDKTAFIHP SSIVEEGAII GAGVYIGPFC IVGSQVEIGA GTELKSHVVV NGITKIGCDN        60
     QIYQFASIGE ANQDLKYAGE PTRVEVGDRN RIRESVTIHR GTTQGGGVTK VGCDNLLMVN       120
     THVAHDCVIG NRCILANNAA LGGHVEIDDY AIIGGMTAIH QFCVIGAHVM VGGCSGITQD       180
     VPPFVIAQGN HATPFGINIE GLKRRGFDKE SLHAIRSAYK LLYRSGRTLD EVKPEIAELA       240
     EQYPVVKAFN DFFARSTRGI IR                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page