(data stored in ACNUC9543 zone)

EMBL: CP000308.PE535

CP000308.PE535       Location/Qualifiers
FT   CDS             621110..622069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0536"
FT                   /product="acetyl-coenzyme A carboxylase carboxyl
FT                   transferase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12504"
FT                   /db_xref="GOA:Q1CAL8"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAL8"
FT                   /protein_id="ABG12504.1"
FT                   /translation="MSLNFLDFEQPIAELEAKIDSLTAVSRQDEKLDINLDEEVQRLRE
FT                   KSVELTRKIFSDLGAWQIAQLARHPRRPYTLDYIANIFTDFEELAGDRAYADDKAIVGG
FT                   IARLDGRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMEMAERFKLPIITFIDT
FT                   PGAYPGVGAEERGQSEAIARNLREMSRLNVPIVCTVIGEGGSGGALAIGVGDKVNMLQY
FT                   STYSVISPEGCASILWKSADKAPLAAEAMGITAHRLKELKMIDSVIPEPLGGAHRDYAA
FT                   IAISLKAQLLADLNDLDVLNDEELLNRRYQRLMNYGYC"
     MSLNFLDFEQ PIAELEAKID SLTAVSRQDE KLDINLDEEV QRLREKSVEL TRKIFSDLGA        60
     WQIAQLARHP RRPYTLDYIA NIFTDFEELA GDRAYADDKA IVGGIARLDG RPVMIIGHQK       120
     GRETKEKIRR NFGMPAPEGY RKALRLMEMA ERFKLPIITF IDTPGAYPGV GAEERGQSEA       180
     IARNLREMSR LNVPIVCTVI GEGGSGGALA IGVGDKVNML QYSTYSVISP EGCASILWKS       240
     ADKAPLAAEA MGITAHRLKE LKMIDSVIPE PLGGAHRDYA AIAISLKAQL LADLNDLDVL       300
     NDEELLNRRY QRLMNYGYC                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page