(data stored in ACNUC9543 zone)

EMBL: CP000308.PE536

CP000308.PE536       Location/Qualifiers
FT   CDS             622253..622651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12505"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037478"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NVW4"
FT                   /protein_id="ABG12505.1"
FT                   /translation="MLAINKIHHIAIICSDYQASKRFYCEVLGFNLISEVYREERDSWK
FT                   ADLALHDQYTIELFSFPSPVPRPSRPEACGLRHLAFQVDDIDLALKELVVAGVVCEAVR
FT                   IDPYTQSRFTFFNDPDGLPLELYELKAE"
     MLAINKIHHI AIICSDYQAS KRFYCEVLGF NLISEVYREE RDSWKADLAL HDQYTIELFS        60
     FPSPVPRPSR PEACGLRHLA FQVDDIDLAL KELVVAGVVC EAVRIDPYTQ SRFTFFNDPD       120
     GLPLELYELK AE                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page